Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GAGE7 Protein

This Human GAGE7 Protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GAGE-7) (AL4) (Cancer/testis antigen 4.7) (CT4.7) (GAGE-12I) (GAGE-7B) (GAGE-8)

UniProt

O76087

Expression Region

1-117aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRXN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1456706 1.0 µg DNA

NRXN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Anti-Inactive DUSP27 antibody
SL14458R-01 50 µL

Rabbit Anti-Inactive DUSP27 antibody

Sign In for Pricing
View Details
Rabbit Anti-Inactive DUSP27 antibody
SL14458R-02 100 µL

Rabbit Anti-Inactive DUSP27 antibody

Sign In for Pricing
View Details
UCKL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49079111 3x 1.0 µg

UCKL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Olr1411 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7333306 1.0 µg DNA

Olr1411 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Pentazocine N-Oxide
462203-01 1 mg

Pentazocine N-Oxide

Sign In for Pricing
View Details