Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asa1 Protein

This asa1 Protein spans the amino acid sequence from region 25-443aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Hemolysin)

UniProt

Q06304

Expression Region

25-443aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Aeromonas sobria

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEPVYPDQVKWAGLGTGVCASGYRPLTRDEAMSIKGNLVSRMGQWQITGLADRWVIMGPGYNGEIKQGTAGETWCYPNSPVSGEIPTLSDWNIPAGDEVDVQWRLVHDNDYFIKPVSYLAHYLGYAWVGGNHSPYVGEDMDVTRVGDGWLIKGNNDGGCSGYRCGEKSSIKVSNFSYTLEPDSFSHGQVTESGKQLVKTITANATNYTDLPQQVVVTLKYDKATNWSKTDTYSLSEKVTTKNKFQWPLVGETELAIEIAASQSWASQKGGSTTETVSVEARPTVPPHSSLPVRVALYKSNISYPYEFKAEVNYDLTMKGFLRWGGNAWYTHPDNRPTWEHTLLLGPFRGQGEQHPLPVDKRYIPGEVKWWDWNWTISEYGLSTMQNNLGRVLRPIRSAVTGDFYAESQFAGDIEIGQPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC3 (hect Domain and RLD 3, KIAA0032) (MaxLight 405)
MBS6195917-01 0.1 mL

HERC3 (hect Domain and RLD 3, KIAA0032) (MaxLight 405)

Sign In for Pricing
View Details
HERC3 (hect Domain and RLD 3, KIAA0032) (MaxLight 405)
MBS6195917-02 5x 0.1 mL

HERC3 (hect Domain and RLD 3, KIAA0032) (MaxLight 405)

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 490)
MBS6206255-01 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 490)

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 490)
MBS6206255-02 5x 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (MaxLight 490)

Sign In for Pricing
View Details
LPAR4 Antibody; Biotin conjugated
MBS7005680-01 0.05 mg

LPAR4 Antibody; Biotin conjugated

Sign In for Pricing
View Details
LPAR4 Antibody; Biotin conjugated
MBS7005680-02 0.1 mg

LPAR4 Antibody; Biotin conjugated

Sign In for Pricing
View Details