Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF3F Protein

This Human EIF3F Protein spans the amino acid sequence from region 2-357aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(eIF3f) (Deubiquitinating enzyme eIF3f) (Eukaryotic translation initiation factor 3 subunit 5) (eIF-3-epsilon) (eIF3 p47)

UniProt

O00303

Expression Region

2-357aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Dickkopf-1 (DKK-1) ELISA Kit
OM626284 96 Tests

Human Dickkopf-1 (DKK-1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human USP53 shRNA (UAS) - Lentiviral human USP53 shRNA (UAS, GFP) plasmid
GTR15133858 1 Vial

Lentiviral human USP53 shRNA (UAS) - Lentiviral human USP53 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rabbit Caspase-5 (CASP5) ELISA Kit
MBS7245280-01 48 Well

Rabbit Caspase-5 (CASP5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Caspase-5 (CASP5) ELISA Kit
MBS7245280-02 96 Well

Rabbit Caspase-5 (CASP5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Caspase-5 (CASP5) ELISA Kit
MBS7245280-03 5x 96 Well

Rabbit Caspase-5 (CASP5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Caspase-5 (CASP5) ELISA Kit
MBS7245280-04 10x 96 Well

Rabbit Caspase-5 (CASP5) ELISA Kit

Sign In for Pricing
View Details