Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pacifastacus leniusculus Astakine Protein

This Pacifastacus leniusculus Astakine Protein spans the amino acid sequence from region 23-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Prokineticin-like cytokine)

UniProt

Q56R11

Expression Region

23-104aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pacifastacus leniusculus (Signal crayfish)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSCNSQEPDCGPSECCLQGWMRYSTRGCAPLGEAGSSCNVFTQAPVKGFYIGMCPCRAGLVCTRPSATCQLPSQDNTLDSYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human FOXD1 pAb
PA12662-01 50 μL

Rabbit Anti-Human FOXD1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FOXD1 pAb
PA12662-02 100 μL

Rabbit Anti-Human FOXD1 pAb

Sign In for Pricing
View Details
MRP-L15 shRNA (h) Lentiviral Particles
sc-77727-V 200 µL

MRP-L15 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HIPK1, Recombinant, Human, GST-Tag (Homeodomain-Interacting Protein Kinase 1, Myak, Nbak2, KIAA0630, MGC26642, MGC33446, MGC33548) discontinued
500067 10 µg

HIPK1, Recombinant, Human, GST-Tag (Homeodomain-Interacting Protein Kinase 1, Myak, Nbak2, KIAA0630, MGC26642, MGC33446, MGC33548) discontinued

Sign In for Pricing
View Details
Mouse AOC3 ELISA Kit (Ready to Use)
orb552933-01 48 Tests

Mouse AOC3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Mouse AOC3 ELISA Kit (Ready to Use)
orb552933-02 96 Tests

Mouse AOC3 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details