Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pyp Protein

This pyp Protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PYP)

UniProt

P81046

Expression Region

1-125aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Halochromatium salexigens (Chromatium salexigens)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNIVHFGSDDIENSLANMSDQDLNQLAFGAIQLDASGKVLQYNAAEEGITGRDPKSVIGKNFFEDVAPCTKSQEFQGRFKEGVANGNLATMFEYVFDYQMKPTKVKVHMKKALVDDSYWIFVKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2,2-Difluoroethyl) piperidine-3-carboxylic acid hydrochloride
DXC59254-01 100 mg

1- (2,2-Difluoroethyl) piperidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
1- (2,2-Difluoroethyl) piperidine-3-carboxylic acid hydrochloride
DXC59254-02 1 g

1- (2,2-Difluoroethyl) piperidine-3-carboxylic acid hydrochloride

Sign In for Pricing
View Details
4-Ethylthiazole-5-carboxylic acid
BFA88907-01 250 mg

4-Ethylthiazole-5-carboxylic acid

Sign In for Pricing
View Details
4-Ethylthiazole-5-carboxylic acid
BFA88907-02 2.5 g

4-Ethylthiazole-5-carboxylic acid

Sign In for Pricing
View Details
PCMV-VSIG2 (human) -3xFLAG-Neo
BZ59084 1 Vial

PCMV-VSIG2 (human) -3xFLAG-Neo

Sign In for Pricing
View Details
FGFBP1 Rabbit Polyclonal Antibody (Fluoro488)
orb3101799 100 µg

FGFBP1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details