Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Blood group RhD polypeptide Protein (Biotin)

This Human Blood group RhD polypeptide Protein (Biotin) spans the amino acid sequence from region 388-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RHXIII) (Rh polypeptide 2) (RhPII) (Rhesus D antigen) (CD antigen CD240D)

UniProt

Q02161

Expression Region

388-417aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7D12]
CF808940 100 µg

SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7D12]

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/2985), CF405S conjugate, 0.1mg/mL
BNC042985-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/2985), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Glucono-1,5-lactone
TRC-G417475-500G 500 g

D-Glucono-1,5-lactone

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS701890 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human CCL22 / MDC, C-hFc Tag
HA211312-01 20 µg

Human CCL22 / MDC, C-hFc Tag

Sign In for Pricing
View Details
Human CCL22 / MDC, C-hFc Tag
HA211312-02 50 µg

Human CCL22 / MDC, C-hFc Tag

Sign In for Pricing
View Details