Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Blood group RhD polypeptide Protein (Biotin)

This Human Blood group RhD polypeptide Protein (Biotin) spans the amino acid sequence from region 388-417aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RHXIII) (Rh polypeptide 2) (RhPII) (Rhesus D antigen) (CD antigen CD240D)

UniProt

Q02161

Expression Region

388-417aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 1 (CLDN1) (NM_021101) Human Over-expression Lysate
LC402832 20 µg

Claudin 1 (CLDN1) (NM_021101) Human Over-expression Lysate

Sign In for Pricing
View Details
STXBP2 Rabbit Polyclonal Antibody
TA362020 100 µL

STXBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Microparticle Stabilizer Solution
C1010002 50 mL

Microparticle Stabilizer Solution

Sign In for Pricing
View Details
alpha 2b Adrenergic Receptor (ADRA2B) Human Gene Knockout Kit (CRISPR)
KN420659 1 Kit

alpha 2b Adrenergic Receptor (ADRA2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GMPR2 (NM_001002001) Human Recombinant Protein
TP310599 20 µg

GMPR2 (NM_001002001) Human Recombinant Protein

Sign In for Pricing
View Details
Glyphosate-13C
TRC-G765001-1MG 1 mg

Glyphosate-13C

Sign In for Pricing
View Details