Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Klrg1 Protein

This Mouse Klrg1 Protein spans the amino acid sequence from region 57-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mast cell function-associated antigen 2F1)

UniProt

O88713

Expression Region

57-188aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb Rabbit Polyclonal Antibody (FITC)
orb9740 100 µL

Rb Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human anti-human GPIIIa IgG
E4A11C87 50 µg

Human anti-human GPIIIa IgG

Sign In for Pricing
View Details
ELISA Kit For L-seryl-tRNA (Sec) kinase
E3962m 96 Tests

ELISA Kit For L-seryl-tRNA (Sec) kinase

Sign In for Pricing
View Details
BAT5 (ABHD16A) (NM_001177515) Human Tagged Lenti ORF Clone
RC230230L3 10 µg

BAT5 (ABHD16A) (NM_001177515) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Citrate synthetase (CS) (NM_004077) Human Recombinant Protein
PH36132M5 20 µg

Citrate synthetase (CS) (NM_004077) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-PLCE1 Antibody Picoband®, Dylight594 Conjugate
A02360-1-Dylight594 100 µg

Anti-PLCE1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details