Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Klrg1 Protein

This Mouse Klrg1 Protein spans the amino acid sequence from region 57-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mast cell function-associated antigen 2F1)

UniProt

O88713

Expression Region

57-188aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP8A1 Antibody (C-term) Blocking Peptide
MBS9227443-01 0.5 mg

CYP8A1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
CYP8A1 Antibody (C-term) Blocking Peptide
MBS9227443-02 5x 0.5 mg

CYP8A1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit
MBS2509157-01 24 Tests (Limit 1)

Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit

Sign In for Pricing
View Details
Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit
MBS2509157-02 48 Tests

Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit

Sign In for Pricing
View Details
Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit
MBS2509157-03 96 Tests

Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit

Sign In for Pricing
View Details
Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit
MBS2509157-04 5x 96 Tests

Mouse ASK1 (Apoptosis Signal Regulating Kinase 1) ELISA Kit

Sign In for Pricing
View Details