Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FlgM Protein

This flgM Protein spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Anti-sigma-28 factor)

UniProt

P0AEM4

Expression Region

1-97aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bsn 3'UTR Lenti-reporter-Luc Vector
13504084 1.0 µg

Bsn 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RFXAP Lentiviral Activation Particles (h2)
sc-406793-LAC-2 200 µL

RFXAP Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
XCT Rabbit Monoclonal Antibody
AMRe83994-01 1 Each

XCT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
XCT Rabbit Monoclonal Antibody
AMRe83994-02 50 µL

XCT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
XCT Rabbit Monoclonal Antibody
AMRe83994-03 100 µL

XCT Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Brilliant Violet 785™ anti-human CD184 (CXCR4)
GT08549 25 Tests

Brilliant Violet 785™ anti-human CD184 (CXCR4)

Sign In for Pricing
View Details