Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tfam Protein

This Mouse Tfam Protein spans the amino acid sequence from region 43-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(mtTFA) (Testis-specific high mobility group protein) (TS-HMG)

UniProt

P40630

Expression Region

43-243aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13C1 (FAM13C) (NM_198215) Human Over-expression Lysate
LH16263V 100 µg

FAM13C1 (FAM13C) (NM_198215) Human Over-expression Lysate

Sign In for Pricing
View Details
SIPA1 Antibody
MBS151345-01 0.1 mg

SIPA1 Antibody

Sign In for Pricing
View Details
SIPA1 Antibody
MBS151345-02 5x 0.1 mg

SIPA1 Antibody

Sign In for Pricing
View Details
NONOP1 Protein Lysate (Human) with C-Ha Tag
31994031 100 µg

NONOP1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-ARHGAP18 Rabbit pAb
GB112346-50 50 μL

Anti-ARHGAP18 Rabbit pAb

Sign In for Pricing
View Details
Hist2h4 sgRNA CRISPR Lentivector set (Mouse)
K3226901 3x 1.0 µg

Hist2h4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details