Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tfam Protein

This Mouse Tfam Protein spans the amino acid sequence from region 43-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(mtTFA) (Testis-specific high mobility group protein) (TS-HMG)

UniProt

P40630

Expression Region

43-243aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABO Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62281R-APC-Cy5.5 100 µL

ABO Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
FASTKD1 (NM_024622) Human 3' UTR Clone
SC200450 10 µg

FASTKD1 (NM_024622) Human 3' UTR Clone

Sign In for Pricing
View Details
Lentiviral mouse Ssxb3 shRNA (UAS) - Lentiviral mouse Ssxb3 shRNA (UAS, iRFP) (25)
GTR15214022 1 Vial

Lentiviral mouse Ssxb3 shRNA (UAS) - Lentiviral mouse Ssxb3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Olfr799 Protein Vector (Mouse) (pPB-C-His)
PV211706 500 ng

Olfr799 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal PIST Antibody [Janelia Fluor 549]
NBP1-77242JF549 0.1 mL

Rabbit Polyclonal PIST Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
TCF19 Protein Vector (Rat) (pPB-N-His)
PV310135 500 ng

TCF19 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details