Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cd3e Protein

This Mouse Cd3e Protein spans the amino acid sequence from region 23-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)

UniProt

P22646

Expression Region

23-108aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK2 (Sphingosine Kinase 2)
252044 100 µL

SPHK2 (Sphingosine Kinase 2)

Sign In for Pricing
View Details
NELFe Rabbit Polyclonal Antibody (BF350)
orb2471897 100 µL

NELFe Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Nrf2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb914631 100 µL

Nrf2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
1- (3,4-Dichlorophenyl) -2- (pyridin-4-yl) ethan-1-amine hydrochloride
LUD63437-01 50 mg

1- (3,4-Dichlorophenyl) -2- (pyridin-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
1- (3,4-Dichlorophenyl) -2- (pyridin-4-yl) ethan-1-amine hydrochloride
LUD63437-02 0.5 g

1- (3,4-Dichlorophenyl) -2- (pyridin-4-yl) ethan-1-amine hydrochloride

Sign In for Pricing
View Details
Anti-IMPG1 Antibody
CTA3566-01 30 µL

Anti-IMPG1 Antibody

Sign In for Pricing
View Details