Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CFI Protein

This Human CFI Protein spans the amino acid sequence from region 239-316aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(C3B/C4B inactivator)

UniProt

P05156

Expression Region

239-316aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rel Protein Vector (Human) (pPM-C-HA)
PV057075 500 ng

Rel Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Taf7l2 shRNA (UAS) - Lentiviral mouseTaf7l2 shRNA (UAS, GFP) (25)
GTR15189032 1 Vial

Lentiviral mouse Taf7l2 shRNA (UAS) - Lentiviral mouseTaf7l2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SB 258741 hydrochloride
T61724-01 25 mg

SB 258741 hydrochloride

Sign In for Pricing
View Details
SB 258741 hydrochloride
T61724-02 50 mg

SB 258741 hydrochloride

Sign In for Pricing
View Details
SB 258741 hydrochloride
T61724-03 100 mg

SB 258741 hydrochloride

Sign In for Pricing
View Details
Polyclonal Antibody to Prolylcarboxypeptidase (PRCP)
TRV-0043227-01 20 µL

Polyclonal Antibody to Prolylcarboxypeptidase (PRCP)

Sign In for Pricing
View Details