Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA1 Protein

This CHRNA1 Protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P02710

Expression Region

25-234aa

Tag

Tag-Free

Source

E.coli

Origin

Torpedo californica (Pacific electric ray)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pineal Gland Frozen Sections*
RF-505 10 Slides

Rat Pineal Gland Frozen Sections*

Sign In for Pricing
View Details
Easypro Rat Pciii (Procollagen III) ELISA Kit
FY-ER1092S 96 Well

Easypro Rat Pciii (Procollagen III) ELISA Kit

Sign In for Pricing
View Details
PPAPDC3 (PLPP7) (NM_032728) Human Over-expression Lysate
LH12932V 100 µg

PPAPDC3 (PLPP7) (NM_032728) Human Over-expression Lysate

Sign In for Pricing
View Details
ALG2 Antibody
orb1335284 100 µg

ALG2 Antibody

Sign In for Pricing
View Details
ITK Rabbit Monoclonal Antibody
E56G0983 100 µL

ITK Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Spcs3 Mouse shRNA Plasmid (Locus ID 76687)
TL519529 1 Kit

Spcs3 Mouse shRNA Plasmid (Locus ID 76687)

Sign In for Pricing
View Details