Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ddt Protein

This Rat Ddt Protein spans the amino acid sequence from region 2-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(D-dopachrome tautomerase)

UniProt

P80254

Expression Region

2-118aa

Tag

N-terminal 10xHis-tagged and C-terminal V5-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor Tyrosine-Protein Kinase ErbB-2 (ERBB2) Antibody
abx136097-01 100 µL

Receptor Tyrosine-Protein Kinase ErbB-2 (ERBB2) Antibody

Sign In for Pricing
View Details
Receptor Tyrosine-Protein Kinase ErbB-2 (ERBB2) Antibody
abx136097-02 200 µL

Receptor Tyrosine-Protein Kinase ErbB-2 (ERBB2) Antibody

Sign In for Pricing
View Details
RecombinantIL-6, His, Mouse
BK0252-01 5 μg

RecombinantIL-6, His, Mouse

Sign In for Pricing
View Details
RecombinantIL-6, His, Mouse
BK0252-02 25 µg

RecombinantIL-6, His, Mouse

Sign In for Pricing
View Details
Clrn2 ORF Vector (Rat) (pORF)
ORF065150 1.0 µg DNA

Clrn2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
GRRP1 (FAM110D) Human shRNA Lentiviral Particle (Locus ID 79927)
TL307303V 500 µL Each

GRRP1 (FAM110D) Human shRNA Lentiviral Particle (Locus ID 79927)

Sign In for Pricing
View Details