Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H1D Protein

This Human HIST1H1D Protein spans the amino acid sequence from region 2-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Histone H1c) (Histone H1s-2)

UniProt

P16402

Expression Region

2-221aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tissue Plasminogen Activator Monoclonal Antibody
AN302005L-01 50 µL

Recombinant Tissue Plasminogen Activator Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Tissue Plasminogen Activator Monoclonal Antibody
AN302005L-02 100 µL

Recombinant Tissue Plasminogen Activator Monoclonal Antibody

Sign In for Pricing
View Details
Human OVCA2 activation kit by CRISPRa
GA114855 1 Kit

Human OVCA2 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), 0.2mg/mL
BNUB0696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), 0.2mg/mL

Sign In for Pricing
View Details
Chloro- (2'-chloro) trityl Polystyrene
H16020033.5G 5 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details
FITC Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001C-01 20 Tests

FITC Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details