Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H1D Protein

This Human HIST1H1D Protein spans the amino acid sequence from region 2-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Histone H1c) (Histone H1s-2)

UniProt

P16402

Expression Region

2-221aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TLE4
Y058303 100 µL

Anti-TLE4

Sign In for Pricing
View Details
Uncoated Mouse MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
E-UNEL-M0006-01 5x 96 Tests

Uncoated Mouse MMP-8 (Matrix Metalloproteinase 8) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse MMP-8 (Matrix Metalloproteinase 8) ELISA Kit
E-UNEL-M0006-02 15x 96 Tests

Uncoated Mouse MMP-8 (Matrix Metalloproteinase 8) ELISA Kit

Sign In for Pricing
View Details
PABPN1 Recombinant Rabbit Monoclonal Antibody [JM11-28]
ET1703-66 100 µL

PABPN1 Recombinant Rabbit Monoclonal Antibody [JM11-28]

Sign In for Pricing
View Details
Acetylated Lysine Rabbit Polyclonal Antibody
AP03035PU-N 100 µg

Acetylated Lysine Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD66 (CEA) (C66/1009), CF647 conjugate, 0.1mg/mL
BNC471009-100 1x 100 µL

CD66 (CEA) (C66/1009), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details