Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSTA Protein

This Human CSTA Protein spans the amino acid sequence from region 2-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cystatin-AS) (Stefin-A)

UniProt

P01040

Expression Region

2-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Occludin Antibody (OCLN/8526R) [DyLight 405]
NBP3-20882V 0.1 mL

Rabbit Monoclonal Occludin Antibody (OCLN/8526R) [DyLight 405]

Sign In for Pricing
View Details
Mouse Interleukin-11 protein
orb669343-01 10 µg

Mouse Interleukin-11 protein

Sign In for Pricing
View Details
Mouse Interleukin-11 protein
orb669343-02 50 µg

Mouse Interleukin-11 protein

Sign In for Pricing
View Details
Mouse Interleukin-11 protein
orb669343-03 500 µg

Mouse Interleukin-11 protein

Sign In for Pricing
View Details
GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (MaxLight 750) discontinued
246524-ML750 100 µL

GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MSF (SEPT9) (NM_001113492) Human Tagged ORF Clone
RC225682 10 µg

MSF (SEPT9) (NM_001113492) Human Tagged ORF Clone

Sign In for Pricing
View Details