Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDK7 Protein

This Human CDK7 Protein spans the amino acid sequence from region 1-346aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(39 kDa protein kinase) (p39 Mo15) (CDK-activating kinase 1) (Cell division protein kinase 7) (Serine/threonine-protein kinase 1) (TFIIH basal transcription factor complex kinase subunit)

UniProt

P50613

Expression Region

1-346aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-PSMA7
YF-PA14107 50 ul

anti-PSMA7

Sign In for Pricing
View Details
SNORD6-set siRNA/shRNA/RNAi Lentivector (Human)
44905091 4x 500 ng

SNORD6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CYP2F1P AAV siRNA Pooled Vector
17413161 1.0 µg

CYP2F1P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Gads (UW40) PE
sc-73652 PE 200 µg/mL

Gads (UW40) PE

Sign In for Pricing
View Details
Anti-AKAP10 Antibody
MBS9239665-01 0.05 mL

Anti-AKAP10 Antibody

Sign In for Pricing
View Details
Anti-AKAP10 Antibody
MBS9239665-02 0.1 mL

Anti-AKAP10 Antibody

Sign In for Pricing
View Details