Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Igfl Protein

This Mouse Igfl Protein spans the amino acid sequence from region 25-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6B9Z0

Expression Region

25-140aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TDP43 Antibody
orb1525226-01 10 µL

Rabbit TDP43 Antibody

Sign In for Pricing
View Details
Rabbit TDP43 Antibody
orb1525226-02 100 µL

Rabbit TDP43 Antibody

Sign In for Pricing
View Details
N-Nitroso-Moxifloxacin D3
CS-O-53645 1 Each

N-Nitroso-Moxifloxacin D3

Sign In for Pricing
View Details
Bromodeoxyuridine (BrdU) (MaxLight 650)
B2850-21-ML650 100 µL

Bromodeoxyuridine (BrdU) (MaxLight 650)

Sign In for Pricing
View Details
LOC100364294 3'UTR Luciferase Stable Cell Line
TU209047 1.0 mL

LOC100364294 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cationic trypsin Antibody
orb53299-01 50 µg

Cationic trypsin Antibody

Sign In for Pricing
View Details