Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNB1 Protein

This Human IFNB1 Protein spans the amino acid sequence from region 22-187aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IFN-beta) (Fibroblast interferon)

UniProt

P01574

Expression Region

22-187aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAD (S118) (Bcl2 antagonist of cell death, BAD, Bcl-2-binding component 6, Bcl-XL/Bcl-2-associated death promoter, Bcl-2-like 8 protein, BAD, BBC6, BCL2L8, ) (AP) discontinued
032376-AP 200 µL

BAD (S118) (Bcl2 antagonist of cell death, BAD, Bcl-2-binding component 6, Bcl-XL/Bcl-2-associated death promoter, Bcl-2-like 8 protein, BAD, BBC6, BCL2L8, ) (AP) discontinued

Sign In for Pricing
View Details
ANKRD54 HDR Plasmid (m)
sc-432385-HDR 20 µg

ANKRD54 HDR Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal HABP1/C1QBP/GC1q R Antibody [DyLight 755]
NBP2-98235IR 0.1 mL

Rabbit Polyclonal HABP1/C1QBP/GC1q R Antibody [DyLight 755]

Sign In for Pricing
View Details
Zkscan3 3'UTR Luciferase Stable Cell Line
TU122981 1.0 mL

Zkscan3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SDHA Antibody
orb2671988-01 50 µL

SDHA Antibody

Sign In for Pricing
View Details
SDHA Antibody
orb2671988-02 100 µL

SDHA Antibody

Sign In for Pricing
View Details