Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human F13B Protein

This Human F13B Protein spans the amino acid sequence from region 260-403aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fibrin-stabilizing factor B subunit) (Protein-glutamine gamma-glutamyltransferase B chain) (Transglutaminase B chain)

UniProt

P05160

Expression Region

260-403aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK36 shRNA Plasmid (h)
sc-95012-SH 20 µg

STK36 shRNA Plasmid (h)

Sign In for Pricing
View Details
Orexin Receptor 1 (HCRTR1) (C-term) Rabbit Polyclonal Antibody
AP23376PU-N 100 µg

Orexin Receptor 1 (HCRTR1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Cystatin S (Cys-S) ELISA Kit
201-11-0912 96 Tests

Rat Cystatin S (Cys-S) ELISA Kit

Sign In for Pricing
View Details
HK3 Protein Vector (Human) (pPM-C-HA)
23417021 500 ng

HK3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Protein tsgA (tsgA), partial
MBS1065172-01 1 mg (E-Coli)

Recombinant Shigella boydii serotype 18 Protein tsgA (tsgA), partial

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Protein tsgA (tsgA), partial
MBS1065172-02 1 mg (Yeast)

Recombinant Shigella boydii serotype 18 Protein tsgA (tsgA), partial

Sign In for Pricing
View Details