Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avian infectious bronchitis virus Spike glycoprotein Protein

This Avian infectious bronchitis virus Spike glycoprotein Protein spans the amino acid sequence from region 317-537aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

UniProt

P12651

Expression Region

317-537aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESNFMYGSYHPSCNFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPSLCKGVYSGELDLNFECGLLVYVTKSGGSRIQTATEPPVITRHNYNNITLNTCVDYNIYGRTGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQGEYGLTYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transthyretin/TTR Protein (His Tag)
PKSH030907 100 µg

Recombinant Human Transthyretin/TTR Protein (His Tag)

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), 1mg/mL
BNUM0144-50 1x 50 µL

Borrelia burgdorferi (p41 Flagellin) (6802), 1mg/mL

Sign In for Pricing
View Details
MAP3K4 Human Gene Knockout Kit (CRISPR)
KN417201 1 Kit

MAP3K4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ropn1l Mouse Gene Knockout Kit (CRISPR)
KN514983 1 Kit

Ropn1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pyrasulfotole
TRC-P847008-10MG 10 mg

Pyrasulfotole

Sign In for Pricing
View Details
CD63 Recombinant Rabbit Monoclonal Antibody [SY21-02]
ET1607-2 100 µL

CD63 Recombinant Rabbit Monoclonal Antibody [SY21-02]

Sign In for Pricing
View Details