Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avian infectious bronchitis virus Spike glycoprotein Protein

This Avian infectious bronchitis virus Spike glycoprotein Protein spans the amino acid sequence from region 317-537aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

UniProt

P12651

Expression Region

317-537aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESNFMYGSYHPSCNFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPSLCKGVYSGELDLNFECGLLVYVTKSGGSRIQTATEPPVITRHNYNNITLNTCVDYNIYGRTGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQGEYGLTYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)
PKSM041339-01 10 µg

Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)
PKSM041339-02 50 µg

Recombinant Mouse EpCAM/TROP-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Atg101 Mouse Gene Knockout Kit (CRISPR)
KN501727 1 Kit

Atg101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Epiandrosterone Sulfate Sodium Salt-d5
TRC-E568022-1MG 1 mg

Epiandrosterone Sulfate Sodium Salt-d5

Sign In for Pricing
View Details
Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF405S conjugate, 0.1mg/mL
BNC042181-100 1x 100 µL

Occludin (Marker of Early Blood Brain Barrier Damage) (OCLN/2181), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF568 conjugate, 0.1mg/mL
BNC682796-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2796), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details