Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human A27L Protein

This Human A27L Protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P33816

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI4B5]
CF810293 100 µg

p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI4B5]

Sign In for Pricing
View Details
TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF405S conjugate, 0.1mg/mL
BNC043017-100 1x 100 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL
BNC742224-500 1x 500 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXO1 Human Knockdown Lysate
LY300502 100 µg

FOXO1 Human Knockdown Lysate

Sign In for Pricing
View Details
C-Reactive Protein Antibody
KC-8496-01 50 μL

C-Reactive Protein Antibody

Sign In for Pricing
View Details
C-Reactive Protein Antibody
KC-8496-02 100 µL

C-Reactive Protein Antibody

Sign In for Pricing
View Details