Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human A27L Protein

This Human A27L Protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P33816

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBX1 Recombinant Rabbit monoclonal Antibody
HA751128 100 µL

RBX1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1-(2,2-Diphenyl-1,3-benzodioxol-5-yl)-2-iodoethanone
TRC-D487220-1G 1 g

1-(2,2-Diphenyl-1,3-benzodioxol-5-yl)-2-iodoethanone

Sign In for Pricing
View Details
15-Acetyl Deoxynivalenol (~90%)
TRC-A173515-1MG 1 mg

15-Acetyl Deoxynivalenol (~90%)

Sign In for Pricing
View Details
CKMT2 (NM_001099735) Human Recombinant Protein
TP324501 20 µg

CKMT2 (NM_001099735) Human Recombinant Protein

Sign In for Pricing
View Details
Human Livin Recombinant Rabbit monoclonal Antibody
HA723499 100 µL

Human Livin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Hieff NGS™ RNA Lib Prep Primer Mix for MGI
13334ES24 24 Tests

Hieff NGS™ RNA Lib Prep Primer Mix for MGI

Sign In for Pricing
View Details