Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag Protein

This gag Protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P16087

Expression Region

1-135aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Feline immunodeficiency virus (isolate Petaluma) (FIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BstX2I, 100U
RE1242 100 U

BstX2I, 100U

Sign In for Pricing
View Details
HELLS (Lymphoid-specific Helicase, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, PASG, SMARCA6, Nbla10143) (MaxLight 550) discontinued
029494-ML550 100 µL

HELLS (Lymphoid-specific Helicase, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, PASG, SMARCA6, Nbla10143) (MaxLight 550) discontinued

Sign In for Pricing
View Details
LRRT2 rabbit pAb Antibody
orb2304712-01 50 µL

LRRT2 rabbit pAb Antibody

Sign In for Pricing
View Details
LRRT2 rabbit pAb Antibody
orb2304712-02 100 µL

LRRT2 rabbit pAb Antibody

Sign In for Pricing
View Details
S (-) -Bisoprolol
orb1689132-01 25 mg

S (-) -Bisoprolol

Sign In for Pricing
View Details
S (-) -Bisoprolol
orb1689132-02 50 mg

S (-) -Bisoprolol

Sign In for Pricing
View Details