Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag Protein

This gag Protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P16087

Expression Region

1-135aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Feline immunodeficiency virus (isolate Petaluma) (FIV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNGQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AMBRA1 shRNA (UAS) - Lentiviral human AMBRA1 shRNA (UAS) plasmid
GTR15123883 1 Vial

Lentiviral human AMBRA1 shRNA (UAS) - Lentiviral human AMBRA1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Simvastatin
C08058-25mg 25 mg

Simvastatin

Sign In for Pricing
View Details
Human CD95 Recombinant Protein C-6 His Tag Lyophilized 50UG
IHUCD95RC6HISLY50UG 50 µg

Human CD95 Recombinant Protein C-6 His Tag Lyophilized 50UG

Sign In for Pricing
View Details
Recombinant Outer-membrane lipoprotein carrier protein
MBS9422712-01 0.02 mg

Recombinant Outer-membrane lipoprotein carrier protein

Sign In for Pricing
View Details
Recombinant Outer-membrane lipoprotein carrier protein
MBS9422712-02 0.1 mg

Recombinant Outer-membrane lipoprotein carrier protein

Sign In for Pricing
View Details
Recombinant Outer-membrane lipoprotein carrier protein
MBS9422712-03 1 mg

Recombinant Outer-membrane lipoprotein carrier protein

Sign In for Pricing
View Details