Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Drosophila Ect4 Protein

This Drosophila Ect4 Protein spans the amino acid sequence from region 370-678aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NADase sarm1) (Sterile alpha and TIR motif-containing protein 1) (Tir-1 homolog)

UniProt

Q6IDD9

Expression Region

370-678aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STX6 Protein Lysate
MBS8428036-01 0.02 mg

Human STX6 Protein Lysate

Sign In for Pricing
View Details
Human STX6 Protein Lysate
MBS8428036-02 5x 0.02 mg

Human STX6 Protein Lysate

Sign In for Pricing
View Details
CDK4 Antibody
MBS7117442-01 0.05 mg

CDK4 Antibody

Sign In for Pricing
View Details
CDK4 Antibody
MBS7117442-02 0.1 mg

CDK4 Antibody

Sign In for Pricing
View Details
CDK4 Antibody
MBS7117442-03 5x 0.1 mg

CDK4 Antibody

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Chorismate synthase (aroC)
MBS1447972-01 0.02 mg (E-Coli)

Recombinant Burkholderia cenocepacia Chorismate synthase (aroC)

Sign In for Pricing
View Details