Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SARM1 Protein

This Human SARM1 Protein spans the amino acid sequence from region 409-702aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NADase SARM1) (hSARM1) (NADP (+) hydrolase SARM1) (Sterile alpha and Armadillo repeat protein) (Sterile alpha and TIR motif-containing protein 1) (Sterile alpha motif domain-containing protein 2) (MyD88-5) (SAM domain-containing protein 2) (Tir-1 homolog) (HsTIR)

UniProt

Q6SZW1

Expression Region

409-702aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMTK3 (N-term) Rabbit Polyclonal Antibody
AP52509PU-N 400 µL

LMTK3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS509886 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI3H4]
CF806354 100 µg

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI3H4]

Sign In for Pricing
View Details
TRITC Conjugated Lens culinaris Lectin (Lentil) -LcH-
R-1401-5 5 mg

TRITC Conjugated Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details
5-Hydroxy Thiabendazole Sulfate, Sodium Salt
TRC-H961210-1MG 1 mg

5-Hydroxy Thiabendazole Sulfate, Sodium Salt

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC Conjugate - Biotium Choice
P015-APC-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC Conjugate - Biotium Choice

Sign In for Pricing
View Details