Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Puccinia triticina Uncharacterized Protein

This Puccinia triticina Uncharacterized Protein spans the amino acid sequence from region 32-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A180H5P9

Expression Region

32-121aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Puccinia triticina (isolate 1-1 / race 1 (BBBD) ) (Brown leaf rust fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IEVIQCGKCNLSVTGESSTMPCPKLKKCGIHTCGNMNRSATAWRCTCGWYKSKPTGTCNQCGAECACKVSTDSYTKKLSRQASSSHWDWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Anti-WNK1 Antibody (Internal)
TA341002 50 µg

Rabbit Polyclonal Anti-WNK1 Antibody (Internal)

Sign In for Pricing
View Details
MAPK13/SAPK4 Rabbit pAb, PerCP-Cy7 conjugated
orb2853101 100 µL

MAPK13/SAPK4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal ZNF202 Antibody (1E9)
H00007753-M01 0.1 mg

Mouse Monoclonal ZNF202 Antibody (1E9)

Sign In for Pricing
View Details
Guinea Pig Carbonic anhydrase related protein 10 (CA10) ELISA kit
GTR10423528 96 Well

Guinea Pig Carbonic anhydrase related protein 10 (CA10) ELISA kit

Sign In for Pricing
View Details
PCB 129 [CAS:55215-18-4] 500ug/ml in Iso-octane
PCB129K5ZT1 1 mL

PCB 129 [CAS:55215-18-4] 500ug/ml in Iso-octane

Sign In for Pricing
View Details
Mmu-miR-468-3p antagomir
HY-RI03207A-01 5 nmol

Mmu-miR-468-3p antagomir

Sign In for Pricing
View Details