Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Puccinia triticina Uncharacterized Protein

This Puccinia triticina Uncharacterized Protein spans the amino acid sequence from region 32-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A180H5P9

Expression Region

32-121aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Puccinia triticina (isolate 1-1 / race 1 (BBBD) ) (Brown leaf rust fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IEVIQCGKCNLSVTGESSTMPCPKLKKCGIHTCGNMNRSATAWRCTCGWYKSKPTGTCNQCGAECACKVSTDSYTKKLSRQASSSHWDWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN-09-5 ClipSleeve Markers
313155 300 Pack (30 Sleeve (s) x 10 Wand)

SCN-09-5 ClipSleeve Markers

Sign In for Pricing
View Details
Ap1s3 (BC098237) Mouse Tagged ORF Clone Lentiviral Particle
MR201140L3V 200 µL

Ap1s3 (BC098237) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Monoclonal CD35 Antibody (CR1/8244R) [Janelia Fluor 646]
NBP3-24210JF646 0.1 mL

Rabbit Monoclonal CD35 Antibody (CR1/8244R) [Janelia Fluor 646]

Sign In for Pricing
View Details
DPOD4 Polyclonal Antibody
ABP58410-01 30 µL

DPOD4 Polyclonal Antibody

Sign In for Pricing
View Details
DPOD4 Polyclonal Antibody
ABP58410-02 100 µL

DPOD4 Polyclonal Antibody

Sign In for Pricing
View Details
DPOD4 Polyclonal Antibody
ABP58410-03 200 µL

DPOD4 Polyclonal Antibody

Sign In for Pricing
View Details