Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FNDC3B Protein

This Human FNDC3B Protein spans the amino acid sequence from region 278-570aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Factor for adipocyte differentiation 104) (HCV NS5A-binding protein 37)

UniProt

Q53EP0

Expression Region

278-570aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Alpha 1 (ITGA1) Antibody
abx455592-01 50 µg

Integrin Alpha 1 (ITGA1) Antibody

Sign In for Pricing
View Details
Integrin Alpha 1 (ITGA1) Antibody
abx455592-02 100 µg

Integrin Alpha 1 (ITGA1) Antibody

Sign In for Pricing
View Details
Hepatitis E Virus ORF2 antigen Rabbit pAb
E47R16495 100 µL

Hepatitis E Virus ORF2 antigen Rabbit pAb

Sign In for Pricing
View Details
Coxsackie Adenovirus Receptor Rabbit Polyclonal Antibody (PerCP)
orb1605346 100 µL

Coxsackie Adenovirus Receptor Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Escherichia coli 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB)
MBS1211917-01 0.02 mg (E-Coli)

Recombinant Escherichia coli 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB)

Sign In for Pricing
View Details
Recombinant Escherichia coli 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB)
MBS1211917-02 0.02 mg (Yeast)

Recombinant Escherichia coli 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB)

Sign In for Pricing
View Details