Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CATSPER1 Protein

This Human CATSPER1 Protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CatSper1) (hCatSper)

UniProt

Q8NEC5

Expression Region

1-445aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTNLFQWLWEKLTFLIQGFREMIRNLTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNPDA1 Protein Vector (Rat) (pPM-C-HA)
PV270752 500 ng

GNPDA1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Clk4 (NM_001013041) Rat Tagged ORF Clone Lentiviral Particle
RR213487L4V 200 µL

Clk4 (NM_001013041) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride
231657-01 100 mg

3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride

Sign In for Pricing
View Details
3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride
231657-02 250 mg

3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride

Sign In for Pricing
View Details
3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride
231657-03 1 g

3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride

Sign In for Pricing
View Details
3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride
231657-04 5 g

3-Benzylpiperidine-3-Ethylcarboxylate Hydrochloride

Sign In for Pricing
View Details