MazF Protein
This mazF Protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Toxin MazF) (mRNA interferase MazF)
UniProt
P0AE70
Expression Region
1-111aa
Tag
C-terminal 6xHis-tagged
Source
Yeast
Origin
Escherichia coli (strain K12)
Field of Research
Epigenetics, Non-Animal
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
493333 100 µL
TAF1D (TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit D)
Sign In for Pricing
View Details GTR15364363 1 Vial
Lentiviral human DDI2 sgRNA gene knockout kit - Lentiviral human DDI2 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 