Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MazF Protein

This mazF Protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Toxin MazF) (mRNA interferase MazF)

UniProt

P0AE70

Expression Region

1-111aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc- (R) -3-Amino-3- (2- hydroxy-phenyl) -propionic acid
CSB-DT3983 1 g

Fmoc- (R) -3-Amino-3- (2- hydroxy-phenyl) -propionic acid

Sign In for Pricing
View Details
Recombinant Human c-fos
MBS7614303-01 0.05 mg

Recombinant Human c-fos

Sign In for Pricing
View Details
Recombinant Human c-fos
MBS7614303-02 0.2 mg

Recombinant Human c-fos

Sign In for Pricing
View Details
Recombinant Human c-fos
MBS7614303-03 1 mg

Recombinant Human c-fos

Sign In for Pricing
View Details
Recombinant Human c-fos
MBS7614303-04 5x 1 mg

Recombinant Human c-fos

Sign In for Pricing
View Details
Fcnb 3'UTR Luciferase Stable Cell Line
TU106485 1.0 mL

Fcnb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details