Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine coronavirus Non-structural protein of 4.9 kDa Protein

This Bovine coronavirus Non-structural protein of 4.9 kDa Protein spans the amino acid sequence from region 1-44aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ns4.9) (4.9 kDa accessory protein)

UniProt

Q9QAS1

Expression Region

1-44aa

Tag

C-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Bovine coronavirus (strain LY-138) (BCoV) (BCV)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTKFVFDLLAPDDILHPFNHVKLIIIRPIEVEHIIIATTMPAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMM50 sgRNA CRISPR Lentivector set (Human)
K2088101 3x 1.0 µg

SAMM50 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MiaB Antibody
orb821037 2 mg

MiaB Antibody

Sign In for Pricing
View Details
Rat Glucokinase ELISA Kit
orb1661143 96 Tests

Rat Glucokinase ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Serum Amyloid A (SAA) protein (N-His tag)
EGPS057D-50 50 µg

Recombinant Human Serum Amyloid A (SAA) protein (N-His tag)

Sign In for Pricing
View Details
LCP1 (phospho-Tyr28) rabbit pAb
E28PP1384 100 µL

LCP1 (phospho-Tyr28) rabbit pAb

Sign In for Pricing
View Details
DiagPoly™ Plain Polystyrene Particles, 700 µm
DMP-L118 0.5 g

DiagPoly™ Plain Polystyrene Particles, 700 µm

Sign In for Pricing
View Details