Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hmgb1 Protein

This Mouse Hmgb1 Protein spans the amino acid sequence from region 2-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(High mobility group protein 1) (HMG-1)

UniProt

P63158

Expression Region

2-215aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC4 Receptor (MC4R) Rabbit Polyclonal Antibody
TA321731 100 µL

MC4 Receptor (MC4R) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIN41 Polyclonal Antibody
E44H09555 100 µL

LIN41 Polyclonal Antibody

Sign In for Pricing
View Details
Mfge8 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4370104 1.0 µg DNA

Mfge8 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
eIF4ENIF1 Protein Lysate (Human) with C-Ha Tag
19169031 100 µg

eIF4ENIF1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
NFAT4/NF-ATc3/NFATC3/NF Rabbit Polyclonal Antibody (HRP)
orb2597219 100 µg

NFAT4/NF-ATc3/NFATC3/NF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
(RS)-35-DHPG
0342/50 50 mg

(RS)-35-DHPG

Sign In for Pricing
View Details