Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hmgb1 Protein

This Mouse Hmgb1 Protein spans the amino acid sequence from region 2-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(High mobility group protein 1) (HMG-1)

UniProt

P63158

Expression Region

2-215aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSBN1, NT (RSBN1, Round spermatid basic protein 1) (PE)
MBS6344204-01 0.2 mL

RSBN1, NT (RSBN1, Round spermatid basic protein 1) (PE)

Sign In for Pricing
View Details
RSBN1, NT (RSBN1, Round spermatid basic protein 1) (PE)
MBS6344204-02 5x 0.2 mL

RSBN1, NT (RSBN1, Round spermatid basic protein 1) (PE)

Sign In for Pricing
View Details
Wnt5B, ID (Protein Wnt-5b) (MaxLight 405) discontinued
W3035-92D-ML405 100 µL

Wnt5B, ID (Protein Wnt-5b) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human CT55 Protein Lysate 20ug
IHUCT55PLLY20UG 20 µg

Human CT55 Protein Lysate 20ug

Sign In for Pricing
View Details
Lentiviral human KCND2 shRNA (UAS) - Lentiviral human KCND2 shRNA (UAS, GFP) (100)
GTR15097413 1 Vial

Lentiviral human KCND2 shRNA (UAS) - Lentiviral human KCND2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Integrator complex subunit 11, CPSF3L ELISA KIT
ELI-20456h 96 Tests

Human Integrator complex subunit 11, CPSF3L ELISA KIT

Sign In for Pricing
View Details