Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccn6 Protein

This Mouse Ccn6 Protein spans the amino acid sequence from region 24-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CCN family member 6) (WNT1-inducible-signaling pathway protein 3) (WISP-3)

UniProt

D3Z5L9

Expression Region

24-354aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPQDSTPGGRPGAALEVYQRTEVCRWPCRCPPQRPTCPPGVSLVRDGCGCCKVCAKQPGDTCNEAEICDPHKGLYCDYSGDTPRYETGVCAYLVAVGCEFNRVYYQNGQVFQPHPLFSCLCVSGAIGCTPLFIPKLAGSNCSAAKGRRKTDPPNCGRGTLQQQNSASYKTMSAYRNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEMRKERRLCYIQPCSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSGCSSTQSYRPTFCGICLDKRCCVPNKSKMITVRFDCPSEGSFKWQMLWVTSCVCQRDCREPGDIFSELRIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol
OR1091139-01 250 mg

(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol
OR1091139-02 500 mg

(3- (benzyloxy) -2,6-dichlorophenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
DVL2 Antibody
OACA07280-50UL 50 µL

DVL2 Antibody

Sign In for Pricing
View Details
TRHDE Antibody
OACA09087-100UL 100 µL

TRHDE Antibody

Sign In for Pricing
View Details
SKP2 / p45 Antibody
abx011526 100 µg

SKP2 / p45 Antibody

Sign In for Pricing
View Details
ZZZ3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
52003065 1.0 µg DNA

ZZZ3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details