Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EDIL3 Protein

This Human EDIL3 Protein spans the amino acid sequence from region 24-480aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1)

UniProt

O43854

Expression Region

24-480aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Med24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4805005 3x 1.0 µg

Med24 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LAMP3 Mouse Monoclonal Antibody [Clone ID: 208B5]
DDX0195P-100 100 µg

LAMP3 Mouse Monoclonal Antibody [Clone ID: 208B5]

Sign In for Pricing
View Details
Mouse RPL28 siRNA
abx931950-01 15 nmol

Mouse RPL28 siRNA

Sign In for Pricing
View Details
Mouse RPL28 siRNA
abx931950-02 30 nmol

Mouse RPL28 siRNA

Sign In for Pricing
View Details
Recombinant Human AGT protein (His tag)
MBS2571318-01 0.02 mg

Recombinant Human AGT protein (His tag)

Sign In for Pricing
View Details
Recombinant Human AGT protein (His tag)
MBS2571318-02 0.1 mg

Recombinant Human AGT protein (His tag)

Sign In for Pricing
View Details