Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROSPA Protein

This TROSPA Protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5SDL7

Expression Region

1-161aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Ixodes scapularis (Black-legged tick) (Deer tick)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM8 Polyclonal Antibody
RD267515A-01 60μL

GRM8 Polyclonal Antibody

Sign In for Pricing
View Details
GRM8 Polyclonal Antibody
RD267515A-02 120μL

GRM8 Polyclonal Antibody

Sign In for Pricing
View Details
GRM8 Polyclonal Antibody
RD267515A-03 200μL

GRM8 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cdr1 shRNA (UAS) - Lentiviral mouse Cdr1 shRNA (UAS, iRFP) (100)
GTR15182955 1 Vial

Lentiviral mouse Cdr1 shRNA (UAS) - Lentiviral mouse Cdr1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Tspan7 Rat shRNA Plasmid (Locus ID 363447)
TR707344 1 Kit

Tspan7 Rat shRNA Plasmid (Locus ID 363447)

Sign In for Pricing
View Details
Human Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit
201-12-2332 96 Tests

Human Sex Determining Region Y Box Protein 2 (SOX2) ELISA Kit

Sign In for Pricing
View Details