Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IZUMO1R Protein

This Human IZUMO1R Protein spans the amino acid sequence from region 20-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Folate receptor 4) (Folate receptor delta) (FR-delta) (IZUMO1 receptor protein JUNO)

UniProt

A6ND01

Expression Region

20-250aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asb6 Mouse Gene Knockout Kit (CRISPR)
KN501661 1 Kit

Asb6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Phenoxyphenol
TRC-P301380-25G 25 g

4-Phenoxyphenol

Sign In for Pricing
View Details
TGF alpha (TGFA) Rabbit Polyclonal Antibody
AP06348PU-N 100 µg

TGF alpha (TGFA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2'-Fluoro-2'-deoxyadenosine
TRC-F590805-500MG 500 mg

2'-Fluoro-2'-deoxyadenosine

Sign In for Pricing
View Details
RSPH1 Antibody
KC-28458-01 50 μL

RSPH1 Antibody

Sign In for Pricing
View Details
RSPH1 Antibody
KC-28458-02 100 µL

RSPH1 Antibody

Sign In for Pricing
View Details