Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Cellular tumor antigen p53 Protein

This Human Cellular tumor antigen p53 Protein spans the amino acid sequence from region 1-393aa (Y220C) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)

UniProt

P04637

Expression Region

1-393aa (Y220C)

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACA
MBS5757876 Inquire

TACA

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (Biotin) discontinued
C2254-60-Biotin 100 µL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (Biotin) discontinued

Sign In for Pricing
View Details
GFP-Human Uterine Microvascular Endothelial Cells
cAP-0023GFP 1 Frozen Vial

GFP-Human Uterine Microvascular Endothelial Cells

Sign In for Pricing
View Details
STFR W017-210x297-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)
828846 1 Card (1 Panel (s) x 1 Pack)

STFR W017-210x297-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rat Anti-Mouse CD40 mAb (PE/Cy5.5)
orb2710712 100 Tests

Rat Anti-Mouse CD40 mAb (PE/Cy5.5)

Sign In for Pricing
View Details
Selenoprotein M Rabbit pAb, AE conjugated
orb2854730 100 µL

Selenoprotein M Rabbit pAb, AE conjugated

Sign In for Pricing
View Details