Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Cellular tumor antigen p53 Protein

This Human Cellular tumor antigen p53 Protein spans the amino acid sequence from region 1-393aa (Y220C) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Antigen NY-CO-13) (Phosphoprotein p53) (Tumor suppressor p53)

UniProt

P04637

Expression Region

1-393aa (Y220C)

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Growth Differentiation Factor 11 (GDF11) ELISA Kit
abx362205 96 Well

Rabbit Growth Differentiation Factor 11 (GDF11) ELISA Kit

Sign In for Pricing
View Details
TUSC4 antibody
70R-21624 50 μL

TUSC4 antibody

Sign In for Pricing
View Details
EAN57 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-14481R-BF594 100 µL

EAN57 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Human CNN1 Protein, N-His-SUMO
E55P5800 50 µg

Recombinant Human CNN1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Human anti-Zika Virus NS1 IgM
A11A35-M 1 Each

Human anti-Zika Virus NS1 IgM

Sign In for Pricing
View Details
2,4-Dibromo-1-methoxynaphthalene
OR1064121-01 1 g

2,4-Dibromo-1-methoxynaphthalene

Sign In for Pricing
View Details