Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPOR Protein

This Human EPOR Protein spans the amino acid sequence from region 25-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(EPO-R)

UniProt

P19235

Expression Region

25-250aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATNX1 (ATX1, Ataxin 1, Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATX1, SCA1) discontinued
A4159-04D 100 µg

ATNX1 (ATX1, Ataxin 1, Ataxin-1, Spinocerebellar Ataxia Type 1 Protein, ATX1, SCA1) discontinued

Sign In for Pricing
View Details
PRKDC Antibody
MBS7132839-01 0.1 mL

PRKDC Antibody

Sign In for Pricing
View Details
PRKDC Antibody
MBS7132839-02 5x 0.1 mL

PRKDC Antibody

Sign In for Pricing
View Details
TGFbR3 (Transforming Growth Factor Beta Receptor III, BGCAN, Beta-Glycan, Betaglycan, Proteoglycan)
365279 200 µL

TGFbR3 (Transforming Growth Factor Beta Receptor III, BGCAN, Beta-Glycan, Betaglycan, Proteoglycan)

Sign In for Pricing
View Details
AGT Antibody (C-term)
orb1928823-01 50 µL

AGT Antibody (C-term)

Sign In for Pricing
View Details
AGT Antibody (C-term)
orb1928823-02 100 µL

AGT Antibody (C-term)

Sign In for Pricing
View Details