Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EPOR Protein

This Human EPOR Protein spans the amino acid sequence from region 25-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(EPO-R)

UniProt

P19235

Expression Region

25-250aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Hyopneumoniae tilS Protein (aa 1-297)
VAng-Lsx06695-500gEcoli 500 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae tilS Protein (aa 1-297)

Sign In for Pricing
View Details
(8S) -8-Amino-7-oxononanoic acid hydrochloride
OR1875T-01 5 mg

(8S) -8-Amino-7-oxononanoic acid hydrochloride

Sign In for Pricing
View Details
(8S) -8-Amino-7-oxononanoic acid hydrochloride
OR1875T-02 10 mg

(8S) -8-Amino-7-oxononanoic acid hydrochloride

Sign In for Pricing
View Details
PSMD12 sgRNA CRISPR Lentivector (Human) (Target 3)
K1743604 1.0 µg DNA

PSMD12 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Monkey Helicobacter pylori IgA ELISA kit
GTR10468942 96 Well

Monkey Helicobacter pylori IgA ELISA kit

Sign In for Pricing
View Details
FGFR substrate 3 Polyclonal Antibody, Cy3 Conjugated
bs-10383R-Cy3 100 µL

FGFR substrate 3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details