Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine FST Protein

This Equine FST Protein spans the amino acid sequence from region 30-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FS) (Activin-binding protein)

UniProt

O62650

Expression Region

30-344aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Equus caballus (Horse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCDNVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVNCPGSSTCVVDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 Mouse mAb, BF647 conjugated
orb3125466 100 µL

CD30 Mouse mAb, BF647 conjugated

Sign In for Pricing
View Details
HARE Lentiviral Activation Particles (h2)
sc-405069-LAC-2 200 µL

HARE Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
PPIL2 (Peptidyl-Prolyl Cis-Trans Isomerase-Like 2, Peptidylprolyl Isomerase (Cyclophilin) -Like 2)
489143 100 µL

PPIL2 (Peptidyl-Prolyl Cis-Trans Isomerase-Like 2, Peptidylprolyl Isomerase (Cyclophilin) -Like 2)

Sign In for Pricing
View Details
Phospho-PKA R2 (Ser99) Peptide
AF3724-BP 1 mg

Phospho-PKA R2 (Ser99) Peptide

Sign In for Pricing
View Details
Apolipoprotein (a) (APO(A)) (APC)
MBS6404741-01 0.1 mL

Apolipoprotein (a) (APO(A)) (APC)

Sign In for Pricing
View Details
Apolipoprotein (a) (APO(A)) (APC)
MBS6404741-02 5x 0.1 mL

Apolipoprotein (a) (APO(A)) (APC)

Sign In for Pricing
View Details