Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE2 Protein

This Human RNASE2 Protein spans the amino acid sequence from region 28-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Eosinophil-derived neurotoxin) (RNase UpI-2) (Ribonuclease 2) (RNase 2) (Ribonuclease US)

UniProt

P10153

Expression Region

28-161aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat GULO Protein, His (Fc)-Avi-tagged
GULO-2415R 50 µg

Recombinant Rat GULO Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Inauhzin
9555-5 5 mg

Inauhzin

Sign In for Pricing
View Details
PCGF1 Antibody - middle region
MBS3221959-01 0.1 mL

PCGF1 Antibody - middle region

Sign In for Pricing
View Details
PCGF1 Antibody - middle region
MBS3221959-02 5x 0.1 mL

PCGF1 Antibody - middle region

Sign In for Pricing
View Details
Human anti-human CD100 mAb
E4A09C15-100 100 µg

Human anti-human CD100 mAb

Sign In for Pricing
View Details
GRID1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV710646 1.0 µg DNA

GRID1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details